PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.8KG002600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 667aa    MW: 70706.1 Da    PI: 6.4493
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.8KG002600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4088.8e-1252976592374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPi 90 
                           +lLl+cAe v++++l  a+++L ++ ela+p g+++qR+aayf+eA++arl++s+ +ly+ lpp + +  + + +++aa+++f+ +sP+
  Pavir.8KG002600.1.p 297 LTLLLQCAESVNADNLDDAHQTLLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPPASPAAARlHGRVAAAFQVFNGISPL 386
                          579************************************************************77666655548899999********** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          +kfsh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g+    s ++l++tg+rL++fA++lg+pfef +
  Pavir.8KG002600.1.p 387 VKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGA----SMDALQATGKRLSDFADTLGLPFEFCA 472
                          ***********************************************************....*************************** PP

                 GRAS 181 lvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                           va++  ++++++L   v ++Ea+aV++ +  h+l+d +++ ++    +L+l+++l Pkvv++veq+++h s+sFl+rf+ea++yysalf
  Pavir.8KG002600.1.p 473 -VAEKAGNVDPDKLlgGVARREAVAVHWLH--HSLYDVTGNDSN----TLWLIQRLAPKVVTMVEQDLSH-SGSFLARFVEAIHYYSALF 554
                          .7************99999**********9..999988888888....**********************.899**************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          dsl+a+++++s er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF++++l  +aa+qa+lll +++sdgy++ ee+g+l
  Pavir.8KG002600.1.p 555 DSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRSASLAGSAAAQASLLLGMFPSDGYTLVEENGAL 643
                          ************************************999987.*********************************************** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                           lgWkd  L+++SaWr
  Pavir.8KG002600.1.p 644 KLGWKDLCLLTASAWR 659
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.653270639IPR005202Transcription factor GRAS
PfamPF035143.0E-122297659IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MGSSSLLLFP SSSSAAPPPT ASAAYSHATS SHSLLPPLPS SQDHLLLHYL HLAEHHQESA  60
AAAMVRKRPA PDMDLPPPRR HVTGDLSDVT AAAAGAGGQP PHQSPASAQL PALPTQLQLP  120
AFQQQQQHAE VEAPPAAAGE VAASTTAWVD GIIRDIIGSS GGAGVSIAQL IHNVREIIHP  180
CNPGLASLLE LRLRSLLNAD PAPPPLPHPP ALLHSTPPAA APAVPALPPP HPLPDKRRHD  240
PQQQEEPNPA PQSPKPPTAE ETAAAAAAAA AAAAAAAKER KEEQRRKQRD EEGLHLLTLL  300
LQCAESVNAD NLDDAHQTLL EIAELATPFG TSTQRVAAYF AEAMSARLVS SCLGLYAPLP  360
PASPAAARLH GRVAAAFQVF NGISPLVKFS HFTANQAIQE AFEREERVHI IDLDIMQGLQ  420
WPGLFHILAS RPGGPPRVRL TGLGASMDAL QATGKRLSDF ADTLGLPFEF CAVAEKAGNV  480
DPDKLLGGVA RREAVAVHWL HHSLYDVTGN DSNTLWLIQR LAPKVVTMVE QDLSHSGSFL  540
ARFVEAIHYY SALFDSLDAS YGEDSPERHV VEQQLLSREI RNVLAVGGPA RTGDVKFGSW  600
REKLAQSGFR SASLAGSAAA QASLLLGMFP SDGYTLVEEN GALKLGWKDL CLLTASAWRP  660
IQTPCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-512966594375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.86650.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0636820.0BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977413.10.0PREDICTED: protein SCARECROW 1-like
SwissprotQ9FUZ70.0SCR_MAIZE; Protein SCARECROW
TrEMBLK7UAQ50.0K7UAQ5_MAIZE; Protein SCARECROW
STRINGGRMZM2G131516_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein